Structure of PDB 8xr6 Chain Q Binding Site BS01

Receptor Information
>8xr6 Chain Q (length=143) Species: 173977 (Chroomonas placoidea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASGDFPKQSYFGAAPISAPFGDTYGTAGAPIWEKLGETEKGIFTRIAQTT
KDQLEQASELISLGSWEASRQRLRMTMYETRKSMVRLTDVDGSKDAKDLF
ATFKKKLEALDRALVAKDKALSIKLIGDVRASYNKWAATVGGV
Ligand information
>8xr6 Chain F (length=29) Species: 173977 (Chroomonas placoidea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TFRWLAIHGLAVPTVFFLGAITSMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xr6 Cryo-EM structure of cryptophyte photosystem II
Resolution2.53 Å
Binding residue
(original residue number in PDB)		K65 Q66 P73 I74 S75 A76
Binding residue
(residue number reindexed from 1)		K7 Q8 P15 I16 S17 A18
External links