Structure of PDB 8rg0 Chain Q Binding Site BS01

Receptor Information
>8rg0 Chain Q (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDIS
EASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPR
Ligand information
>8rg0 Chain 7 (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacaacaacaacaaggauccaaaacagacc
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rg0 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R42 H80
Binding residue
(residue number reindexed from 1)		R38 H76
External links
PDB RCSB:8rg0, PDBe:8rg0, PDBj:8rg0
PDBsum8rg0
PubMed
UniProtP62854|RS26_HUMAN Small ribosomal subunit protein eS26 (Gene Name=RPS26)

[Back to BioLiP]