Structure of PDB 8ic3 Chain Q Binding Site BS01

Receptor Information
>8ic3 Chain Q (length=118) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKME
FDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEK
KVPKPKSKSYGANFSWNK
Ligand information
>8ic3 Chain s (length=29) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DYNTYTFLDLNLDLSKFRLPQPSSGRESP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ic3 Respiratory complex Peripheral Arm of CI, focus-refined map of type I, PERK -/- mouse under cold temperature
Resolution3.2 Å
Binding residue
(original residue number in PDB)		W166 N167
Binding residue
(residue number reindexed from 1)		W116 N117
External links
PDB RCSB:8ic3, PDBe:8ic3, PDBj:8ic3
PDBsum8ic3
PubMed
UniProtQ9CXZ1|NDUS4_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial (Gene Name=Ndufs4)

[Back to BioLiP]