Structure of PDB 8hih Chain Q Binding Site BS01

Receptor Information
>8hih Chain Q (length=213) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDA
RNDLSSGRGLCRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLLSTG
PAEIDARLRLVVGLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKY
LAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGPEHEALIG
TVRNVGYKAVRPA
Ligand information
>8hih Chain K (length=77) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cttcgtcacggcggcgaaacaacgaggggcttccaccgaaaccgcgctgc
gttataatgggagctgtcacggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hih Structural insights into the transcription activation mechanism of the global regulator GlnR from actinobacteria.
Resolution3.66 Å
Binding residue
(original residue number in PDB)
T151 Y152 K153 W179 G186 T187 R188 T189 V192 R196 R213
Binding residue
(residue number reindexed from 1)
T141 Y142 K143 W169 G176 T177 R178 T179 V182 R186 R203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
GO:0042128 nitrate assimilation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0032993 protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8hih, PDBe:8hih, PDBj:8hih
PDBsum8hih
PubMed37216560
UniProtO53830

[Back to BioLiP]