Structure of PDB 8euf Chain Q Binding Site BS01

Receptor Information
>8euf Chain Q (length=421) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEIDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDNLINAVMQFRKV
CNHPDLFERADVDSPFSFTTFGKTTSKFTDLIYSSRNPIKYSLPRLIYED
LILPNYNNDVDIANKLKNVKFNIFNPSTNYELCLFLSKLTGEPSLNEFFR
VSTTPLLKRVIERTNGPKNTDSLSFKTITQELLEVTRNAPSEGVMASLLN
VEKHAYEREYLNCIQRGYHPNVSAPPVTIEVLGSSHVTNSINNELFDPLI
SQALSDIPAITQYNMHVKKGIPVEDFPKTGLFPEPLNKNFSSNISMPSMD
RFITESAKLRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNH
IRLDLVHDWQTNPEIFVFLLSTNLTAADTVIFYDSDWNPTIDSQAMDRAT
RQVTVYRLLVRGTIEERMRDR
Ligand information
>8euf Chain Z (length=28) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVKPRRPYNSEGMTRILRRYEEDLFCTF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8euf Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.41 Å
Binding residue
(original residue number in PDB)		I1252 Y1255
Binding residue
(residue number reindexed from 1)		I260 Y263
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0042393 histone binding
GO:0043138 3'-5' DNA helicase activity
GO:0140658 ATP-dependent chromatin remodeler activity
Biological Process
GO:0000722 telomere maintenance via recombination
GO:0006281 DNA repair
GO:0006338 chromatin remodeling
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006366 transcription by RNA polymerase II
GO:0019222 regulation of metabolic process
GO:0031509 subtelomeric heterochromatin formation
GO:0032006 regulation of TOR signaling
GO:0032508 DNA duplex unwinding
GO:0033554 cellular response to stress
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0031011 Ino80 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8euf, PDBe:8euf, PDBj:8euf
PDBsum8euf
PubMed37384669
UniProtP53115|INO80_YEAST Chromatin-remodeling ATPase INO80 (Gene Name=INO80)

[Back to BioLiP]