Structure of PDB 7zi4 Chain Q Binding Site BS01

Receptor Information
>7zi4 Chain Q (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAP
PSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLA
LRKATSI
Ligand information
>7zi4 Chain Y (length=158) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatcccgagtacatgcacaggatgtatatatctgacacgtgcctg
gagactagggagtaatccccttggcggttaaaacgcgggggacagcgcgt
acgtgcgtttaagcggtgctagagctgtctacgaccaattgagcggcctc
ggcaccgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zi4 Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K136 R139
Binding residue
(residue number reindexed from 1)		K17 R20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000723 telomere maintenance
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006310 DNA recombination
GO:0006338 chromatin remodeling
GO:0033044 regulation of chromosome organization
GO:0045739 positive regulation of DNA repair
GO:0045893 positive regulation of DNA-templated transcription
GO:0045995 regulation of embryonic development
GO:0051726 regulation of cell cycle
GO:0060382 regulation of DNA strand elongation
GO:1904507 positive regulation of telomere maintenance in response to DNA damage
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0031011 Ino80 complex
GO:0071339 MLL1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zi4, PDBe:7zi4, PDBj:7zi4
PDBsum7zi4
PubMed
UniProtQ6PI98|IN80C_HUMAN INO80 complex subunit C (Gene Name=INO80C)

[Back to BioLiP]