Structure of PDB 7w0n Chain Q Binding Site BS01

Receptor Information
>7w0n Chain Q (length=297) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVAD
LTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSF
DRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLEN
TTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIA
QTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGS
LLHWPCDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w0n Structural insight into apelin receptor-G protein stoichiometry.
Resolution4.21 Å
Binding residue
(original residue number in PDB)		Y35 W85 Y93 F110 C181 M183 F291 P292 T295 Y299
Binding residue
(residue number reindexed from 1)		Y10 W60 Y68 F85 C156 M158 F266 P267 T270 Y274
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0022900 electron transport chain
Cellular Component
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w0n, PDBe:7w0n, PDBj:7w0n
PDBsum7w0n
PubMed35817871
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P35414|APJ_HUMAN Apelin receptor (Gene Name=APLNR)

[Back to BioLiP]