Structure of PDB 7lbm Chain Q Binding Site BS01

Receptor Information

>7lbm Chain Q (length=184) Species: 9606 (Homo sapiens)

PAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETRHNYYFINYRTLVNVVKYKLDHMRRRIETD
ERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESA
MPKKDARTLLARFNEQIEPIYALLRETEDVNLAY

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7lbm Chain Q Residue 501

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7lbm Structure of the human Mediator-bound transcription preinitiation complex.
• Resolution: 4.8 Å
• Binding residue (original residue number in PDB): C132 C154
• Binding residue (residue number reindexed from 1): C115 C137
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016251 RNA polymerase II general transcription initiation factor activity
• GO:0046872 metal ion binding

Biological Process

• GO:0001113 transcription open complex formation at RNA polymerase II promoter
• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005669 transcription factor TFIID complex
• GO:0005673 transcription factor TFIIE complex
• GO:0005829 cytosol

External links

• PDB: RCSB:7lbm, PDBe:7lbm, PDBj:7lbm
• PDBsum: 7lbm
• PubMed: 33707221
• UniProt: P29083|T2EA_HUMAN General transcription factor IIE subunit 1 (Gene Name=GTF2E1)