Structure of PDB 6ruo Chain Q Binding Site BS01

Receptor Information
>6ruo Chain Q (length=430) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMEGDVEFNDDEDHEAKLL
FLKSFQFILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELK
LQLHMTSTISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILPKSW
RIQLPNYYVSILEGSISPFNGQLYNKIALTCGMIHFKEFFNSEISCQGLL
LKLVMQCALPPEFYFYTKQVIEFEETDIRNLTLWERTDERHTGRVSNHAE
LRVLSYFMLTINWMLSFDRDRQYPLKWILSLTESLTQRTTTSESIGRNIV
KVVYPDKPTSSDYFQWSEEETLEFLKWMEKQFLPTDQKIARRKLYKIFPL
DREANHDGEFNDSTHQLTFIEDLQERYAKQTPFFPPARKEAIGRLLTHIA
SQLLVDFAISKEQLKDCISRIKNACLHRMN
Ligand information
>6ruo Chain T (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
actgctttcgcatgaacctcccaactacttttcctcacacttgtactcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ruo Molecular insight into RNA polymerase I promoter recognition and promoter melting.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		D46 L154 Q155 L156 H157 T159 N209 Y210 I214 Q225 K229 R293 H294 T295 H511
Binding residue
(residue number reindexed from 1)		D44 L101 Q102 L103 H104 T106 N156 Y157 I161 Q172 K176 R240 H241 T242 H427
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006360 transcription by RNA polymerase I
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
Cellular Component
GO:0000120 RNA polymerase I transcription regulator complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0070860 RNA polymerase I core factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ruo, PDBe:6ruo, PDBj:6ruo
PDBsum6ruo
PubMed31804486
UniProtP40992|RRN7_YEAST RNA polymerase I-specific transcription initiation factor RRN7 (Gene Name=RRN7)

[Back to BioLiP]