Structure of PDB 6ff7 Chain Q Binding Site BS01

Receptor Information
>6ff7 Chain Q (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRI
HHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCC
LRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCR
Ligand information
>6ff7 Chain 6 (length=95) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcg
<<<<<.<<....>>>>>>>...............................
......<<...<<<.....>>>....>>.................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ff7 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
Resolution4.5 Å
Binding residue
(original residue number in PDB)
R41 G96 N116 R120 E133 T135
Binding residue
(residue number reindexed from 1)
R39 G94 N114 R118 E131 T133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045893 positive regulation of DNA-templated transcription
GO:2000825 positive regulation of androgen receptor activity
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0071007 U2-type catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ff7, PDBe:6ff7, PDBj:6ff7
PDBsum6ff7
PubMed29361316
UniProtP41223|BUD31_HUMAN Protein BUD31 homolog (Gene Name=BUD31)

[Back to BioLiP]