Structure of PDB 6c23 Chain Q Binding Site BS01

Receptor Information
>6c23 Chain Q (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRK
TFKVDDMLSKVEKMKG
Ligand information
>6c23 Chain E (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PATQISDLSKRKPKTEDFLTFLCLRGS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c23 Structures of human PRC2 with its cofactors AEBP2 and JARID2.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Q95 R98
Binding residue
(residue number reindexed from 1)		Q15 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001222 transcription corepressor binding
GO:0003682 chromatin binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0031490 chromatin DNA binding
GO:0035064 methylated histone binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0106222 lncRNA binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0045596 negative regulation of cell differentiation
GO:0048709 oligodendrocyte differentiation
GO:0060816 random inactivation of X chromosome
GO:0140718 facultative heterochromatin formation
Cellular Component
GO:0001739 sex chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005677 chromatin silencing complex
GO:0005730 nucleolus
GO:0016586 RSC-type complex
GO:0016604 nuclear body
GO:0032993 protein-DNA complex
GO:0035098 ESC/E(Z) complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c23, PDBe:6c23, PDBj:6c23
PDBsum6c23
PubMed29348366
UniProtQ15022|SUZ12_HUMAN Polycomb protein SUZ12 (Gene Name=SUZ12)

[Back to BioLiP]