Structure of PDB 5w65 Chain Q Binding Site BS01

Receptor Information

>5w65 Chain Q (length=349) Species: 559292 (Saccharomyces cerevisiae S288C)

MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKSDEERKFWKKYEKP
EKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKEN
KLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYK
IFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRF
VQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPTENDLLQE
LIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIG
LDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLY

Ligand information

>5w65 Chain S (length=45)

caagtgtgaggaaaagtagttgggttttttttgcagttgaagaca

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5w65 Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
• Resolution: 4.3 Å
• Binding residue (original residue number in PDB): R125 T181 K182 E183 N207 F284 N287
• Binding residue (residue number reindexed from 1): R41 T97 K98 E99 N123 F200 N203

Gene Ontology

Molecular Function

• GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
• GO:0001181 RNA polymerase I general transcription initiation factor activity
• GO:0005515 protein binding
• GO:0017025 TBP-class protein binding

Biological Process

• GO:0001188 RNA polymerase I preinitiation complex assembly
• GO:0006361 transcription initiation at RNA polymerase I promoter
• GO:0042790 nucleolar large rRNA transcription by RNA polymerase I

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0070860 RNA polymerase I core factor complex

External links

• PDB: RCSB:5w65, PDBe:5w65, PDBj:5w65
• PDBsum: 5w65
• PubMed: 28623663
• UniProt: Q04712|RRN11_YEAST RNA polymerase I-specific transcription initiation factor RRN11 (Gene Name=RRN11)