Structure of PDB 5w64 Chain Q Binding Site BS01

Receptor Information
>5w64 Chain Q (length=349) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKSDEERKFWKKYEKP
EKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHCTKEN
KLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYK
IFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRF
VQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPTENDLLQE
LIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIG
LDRDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKSFESRLY
Ligand information
>5w64 Chain S (length=42) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caagtgtgaggaaaagtagttgggtttttgcagttgaagaca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w64 Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
Resolution4.2 Å
Binding residue
(original residue number in PDB)
R125 T181 K182 N207 N287
Binding residue
(residue number reindexed from 1)
R41 T97 K98 N123 N203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
GO:0001181 RNA polymerase I general transcription initiation factor activity
GO:0005515 protein binding
GO:0017025 TBP-class protein binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0070860 RNA polymerase I core factor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5w64, PDBe:5w64, PDBj:5w64
PDBsum5w64
PubMed28623663
UniProtQ04712|RRN11_YEAST RNA polymerase I-specific transcription initiation factor RRN11 (Gene Name=RRN11)

[Back to BioLiP]