Structure of PDB 5n61 Chain Q Binding Site BS01

Receptor Information
>5n61 Chain Q (length=389) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFIRGPICGTDNCPSRLWRIIDGRRTCQYGHVMKLIGHEAKLLFLKSFQF
ILKRQIRWLITEMRFPKEFEHVAKIIWLKILKTINDQPQEELKLQLHMTS
TISILYLASTHLSLPVYTCDYIKWICTAKMPYFQASEILQLYNKIALTCG
MIHFKEFFNSEISCQGLLLKLVMQCALPPEFYFYTKQVIEFEETDIRNLT
LWERTDERHTGRVSNHAELRVLSYFMLTINWMLSFDRDRQYPLKWILSLT
ESLTQRTTTSESIGRNIVKVVYPDKPTSSDYFQWSEEETLEFLKWMEKQF
LPTQTDQKIARRKLYKIFPLDSTHQLTFIEDLQERYAKQTPFFPPARKEA
IGRLLTHIASQLLVDFAISKEQLKDCISRIKNACLHRMN
Ligand information
>5n61 Chain T (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttgtcttcaactgctttcgcgatgcatgcatgcatgcatgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5n61 Structural Basis of RNA Polymerase I Transcription Initiation.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
F104 L154 Q155 H157
Binding residue
(residue number reindexed from 1)
F44 L94 Q95 H97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006360 transcription by RNA polymerase I
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
Cellular Component
GO:0000120 RNA polymerase I transcription regulator complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0070860 RNA polymerase I core factor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5n61, PDBe:5n61, PDBj:5n61
PDBsum5n61
PubMed28340337
UniProtP40992|RRN7_YEAST RNA polymerase I-specific transcription initiation factor RRN7 (Gene Name=RRN7)

[Back to BioLiP]