Structure of PDB 4xgz Chain Q Binding Site BS01

Receptor Information
>4xgz Chain Q (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEVQLVESGGGLVQPGGSLRLSCAASGFNVSYSSIHWVRQAPGKGLEWVA
SIYSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARG
YYGAAMDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEPKSCD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xgz Engineering Synthetic Antibody Inhibitors Specific for LD2 or LD4 Motifs of Paxillin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y31 S33 Y52 Y53 Y54 Y58 G95 Y96 Y97 A99
Binding residue
(residue number reindexed from 1)		Y32 S34 Y53 Y55 Y56 Y60 G100 Y101 Y102 A104
External links