Structure of PDB 4ru2 Chain Q Binding Site BS01

Receptor Information
>4ru2 Chain Q (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDK
YSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD
SMTATQLLVPSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ru2 Crystal structure of a RNA-binding protein 39 (RBM39) in complex with fragment of splicing factor (U2AF) from Mus musculus at 2.20 A resolution
Resolution2.2 Å
Binding residue
(original residue number in PDB)
E445 D449 E453 R494 W495 F496 A497 G498 I501 R529
Binding residue
(residue number reindexed from 1)
E28 D32 E36 R77 W78 F79 A80 G81 I84 R112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4ru2, PDBe:4ru2, PDBj:4ru2
PDBsum4ru2
PubMed
UniProtQ8VH51|RBM39_MOUSE RNA-binding protein 39 (Gene Name=Rbm39)

[Back to BioLiP]