Structure of PDB 4riq Chain Q Binding Site BS01

Receptor Information
>4riq Chain Q (length=49) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQF
Ligand information
>4riq Chain R (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AMGSVEHTLADVLYHVETEVENLY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4riq Molecular Basis for DPY-30 Association to COMPASS-like and NURF Complexes.
Resolution2.231 Å
Binding residue
(original residue number in PDB)		T53 R54 L66 L69
Binding residue
(residue number reindexed from 1)		T7 R8 L20 L23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0048188 Set1C/COMPASS complex

View graph for
Cellular Component
External links
PDB RCSB:4riq, PDBe:4riq, PDBj:4riq
PDBsum4riq
PubMed25456412
UniProtQ9C005|DPY30_HUMAN Protein dpy-30 homolog (Gene Name=DPY30)

[Back to BioLiP]