Structure of PDB 4pjo Chain Q Binding Site BS01

Receptor Information
>4pjo Chain Q (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGSVKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTL
KNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVD
Ligand information
>4pjo Chain 3 (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuuaccuggcagugaggugcacacacugcauaauuugugguagu
...........<<<<<<.........>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		E18 L19 K20 G22 S35 K48 R61 R66
Binding residue
(residue number reindexed from 1)		E21 L22 K23 G25 S38 K51 R64 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0006396 RNA processing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP62314|SMD1_HUMAN Small nuclear ribonucleoprotein Sm D1 (Gene Name=SNRPD1)

[Back to BioLiP]