Structure of PDB 4p2r Chain Q Binding Site BS01

Receptor Information

>4p2r Chain Q (length=171) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SRPWFLEYCKSECHFYNGTQRVRLLVRYFYNLEENLRFDSDVGEFRAVTE
LGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEIFDNFLVPRRVEPTVTVY
PLLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLE
TVYTCQVEHPSLTDPVTVEWK

Ligand information

>4p2r Chain R (length=13) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ANGVAFFLTPFKA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4p2r Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
Resolution	3.295 Å
Binding residue (original residue number in PDB)	S13 L26 D57 W61 E74 V78 H81 N82 I85 F86
Binding residue (residue number reindexed from 1)	S11 L24 D55 W59 E72 V76 H79 N80 I83 F84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4p2r, PDBe:4p2r, PDBj:4p2r
PDBsum	4p2r
PubMed	24855945
UniProt	Q31163

[Back to BioLiP]