Structure of PDB 4ndy Chain Q Binding Site BS01

Receptor Information
>4ndy Chain Q (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAK
DLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQ
KKKKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ndy The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
Resolution6.999 Å
Binding residue
(original residue number in PDB)		T76 K114
Binding residue
(residue number reindexed from 1)		T63 K101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0071821 FANCM-MHF complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4ndy, PDBe:4ndy, PDBj:4ndy
PDBsum4ndy
PubMed24390579
UniProtQ8N2Z9|CENPS_HUMAN Centromere protein S (Gene Name=CENPS)

[Back to BioLiP]