Structure of PDB 3jcm Chain Q Binding Site BS01

Receptor Information
>3jcm Chain Q (length=89) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVL
ENVKELWTEKKKNVINRERFISKLFLRGDSVIVVLKTPV
Ligand information
>3jcm Chain E (length=85) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auccuuaugcacgggaaauacgcauaucagugaggauucguccgagauug
uguuuuugcugguuagggaauuuuuggaauaccuu
...................<<<<<.<<<.....<<<....>>>..>>>>>
>>>................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcm The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G98 D99
Binding residue
(residue number reindexed from 1)		G78 D79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008150 biological_process
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030532 small nuclear ribonucleoprotein complex
GO:0032991 protein-containing complex
GO:0034715 pICln-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcm, PDBe:3jcm, PDBj:3jcm
PDBsum3jcm
PubMed26743623
UniProtQ06217|SMD2_YEAST Small nuclear ribonucleoprotein Sm D2 (Gene Name=SMD2)

[Back to BioLiP]