Structure of PDB 3ise Chain Q Binding Site BS01

Receptor Information

>3ise Chain Q (length=154) Species: 287 (Pseudomonas aeruginosa)

GDKKVIQHLNKILGNELIAINQYFLHSRMWNDWGLKRLGAHEYHESIDEM
KHADKLIERILFLEGLPNLQDLGKLLIGENTQEMLQCDLNLELKATKDLR
EAIVHCEQVHDYVSRDLLKDILESEEEHIDYLETQLGLIQKVGLENYLQS
HMHE

Ligand information

• Ligand ID: FE
• InChI: InChI=1S/Fe/q+3
• InChIKey: VTLYFUHAOXGGBS-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Fe+3]
• Formula: Fe
• Name: FE (III) ION
• DrugBank: DB13949
• PDB chain: 3ise Chain Q Residue 159

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3ise Structural Studies of Bacterioferritin B from Pseudomonas aeruginosa Suggest a Gating Mechanism for Iron Uptake via the Ferroxidase Center
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): R39 H153
• Binding residue (residue number reindexed from 1): R37 H151
• Annotation score: 5

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0015093 ferrous iron transmembrane transporter activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion
• GO:0034755 iron ion transmembrane transport

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0070288 ferritin complex

External links

• PDB: RCSB:3ise, PDBe:3ise, PDBj:3ise
• PDBsum: 3ise
• PubMed: 20067302
• UniProt: Q9HY79