Structure of PDB 2nx5 Chain Q Binding Site BS01

Receptor Information
>2nx5 Chain Q (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>2nx5 Chain S (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPLPQGQLTAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2nx5 A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 N63 I66 F67 N70 Y74 S77 N80 Y84 R97 Y99 S116 T143 W147 A150 V152 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y59 R62 N63 I66 F67 N70 Y74 S77 N80 Y84 R97 Y99 S116 T143 W147 A150 V152 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2nx5, PDBe:2nx5, PDBj:2nx5
PDBsum2nx5
PubMed17259989
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]