Structure of PDB 4wzj Chain PPP Binding Site BS01

Receptor Information
>4wzj Chain PPP (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFREKRV
LGLVLLRGENLVSMTVEGPPP
Ligand information
>4wzj Chain YYY (length=68) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgugacgacugaaaagucggcauuggcaauuuuugacagucucuaugg
guaaccuaaggagacugg
<<<<<<.<<<<<....>>>>>.>>>.>>>.........<<<<<<<<..<<
....>>...>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wzj Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K36 H37 N39 R73 E75
Binding residue
(residue number reindexed from 1)		K33 H34 N36 R57 E59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4wzj, PDBe:4wzj, PDBj:4wzj
PDBsum4wzj
PubMed21516107
UniProtP14678|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' (Gene Name=SNRPB)

[Back to BioLiP]