Structure of PDB 8z99 Chain P Binding Site BS01

Receptor Information
>8z99 Chain P (length=194) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPFK
GALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASVD
FLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISN
PQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATD
Ligand information
>8z99 Chain M (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuua
aguc
..................................................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z99 Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G21 V23 F37 R40 P50 K52 G53 A54 R56 G74 F90 G91 S92 M93 R95 T118 H119 L120 R121 I122 R124 K127 F133 G174 N178
Binding residue
(residue number reindexed from 1)		G19 V21 F35 R38 P48 K50 G51 A52 R54 G72 F88 G89 S90 M91 R93 T116 H117 L118 R119 I120 R122 K125 F131 G172 N176
External links