Structure of PDB 8pib Chain P Binding Site BS01

Receptor Information
>8pib Chain P (length=135) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPL
CPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYK
PEGAFEGFQAIFTEPDGEARCMLLLNLINKEIKHS
Ligand information
>8pib Chain B (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaagatcgaaaaaagcacgctaccgcccgcgtggtggtg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pib Concerted transformation of a hyper-paused transcription complex and its reinforcing protein.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
R11 G12 R40
Binding residue
(residue number reindexed from 1)
R11 G12 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0001073 transcription antitermination factor activity, DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008494 translation activator activity
GO:0061980 regulatory RNA binding
Biological Process
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0045727 positive regulation of translation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pib, PDBe:8pib, PDBj:8pib
PDBsum8pib
PubMed38589445
UniProtP0AFW0|RFAH_ECOLI Transcription antitermination protein RfaH (Gene Name=rfaH)

[Back to BioLiP]