Structure of PDB 8pib Chain P Binding Site BS01

Receptor Information

>8pib Chain P (length=135) Species: 562 (Escherichia coli)

MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPL
CPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYK
PEGAFEGFQAIFTEPDGEARCMLLLNLINKEIKHS

Ligand information

>8pib Chain B (length=40)

ggaagatcgaaaaaagcacgctaccgcccgcgtggtggtg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8pib Concerted transformation of a hyper-paused transcription complex and its reinforcing protein.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): R11 G12 R40
• Binding residue (residue number reindexed from 1): R11 G12 R40

Gene Ontology

Molecular Function

• GO:0001000 bacterial-type RNA polymerase core enzyme binding
• GO:0001073 transcription antitermination factor activity, DNA binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008494 translation activator activity
• GO:0061980 regulatory RNA binding

Biological Process

• GO:0006354 DNA-templated transcription elongation
• GO:0006355 regulation of DNA-templated transcription
• GO:0031564 transcription antitermination
• GO:0045727 positive regulation of translation
• GO:0140673 transcription elongation-coupled chromatin remodeling

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:8pib, PDBe:8pib, PDBj:8pib
• PDBsum: 8pib
• PubMed: 38589445
• UniProt: P0AFW0|RFAH_ECOLI Transcription antitermination protein RfaH (Gene Name=rfaH)