Structure of PDB 8pfg Chain P Binding Site BS01

Receptor Information
>8pfg Chain P (length=136) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQSWYLLYCKRGQLQRAQEHLERQAVNCLAPMITLEKIVRGKRTAVSEPL
CPNYLFVEFDPEVIHTTTINATRGVSHFVRFGASPAIVPSAVIHQLSVYK
PKGAFEGFQAIFTEPDGEARCMLLLNLINKEIKHSV
Ligand information
>8pfg Chain A (length=40) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caccaccacgcgggcggtagcgtgcttttttcgatcttcc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pfg Concerted transformation of a hyper-paused transcription complex and its reinforcing protein.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
K10 H20 Q24 R40 N70 A71 T72 R73 G74 V75
Binding residue
(residue number reindexed from 1)
K10 H20 Q24 R40 N70 A71 T72 R73 G74 V75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001000 bacterial-type RNA polymerase core enzyme binding
GO:0001073 transcription antitermination factor activity, DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008494 translation activator activity
GO:0061980 regulatory RNA binding
Biological Process
GO:0006354 DNA-templated transcription elongation
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0045727 positive regulation of translation
GO:0140673 transcription elongation-coupled chromatin remodeling
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8pfg, PDBe:8pfg, PDBj:8pfg
PDBsum8pfg
PubMed38589445
UniProtP0AFW0|RFAH_ECOLI Transcription antitermination protein RfaH (Gene Name=rfaH)

[Back to BioLiP]