Structure of PDB 8iue Chain P Binding Site BS01

Receptor Information
>8iue Chain P (length=303) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQL
DLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIR
YKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSVTG
GAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQRNSSFASS
HEVWKYICELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSV
DGHMKLYRAVNPIIPPTGLVRAPCGLCPVFDDCHEGGEISPSNCIYMTEW
LEF
Ligand information
>8iue Chain X (length=74) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatgcttaccgtaacttgaaagtatttcgatttcttggctttatatatc
ttgtggaaaggacgcttcggcagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iue Structure of the SNAPc-bound RNA polymerase III preinitiation complex.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R110 K146
Binding residue
(residue number reindexed from 1)		R97 K133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0032728 positive regulation of interferon-beta production
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0051607 defense response to virus
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iue, PDBe:8iue, PDBj:8iue
PDBsum8iue
PubMed37165065
UniProtQ9H1D9|RPC6_HUMAN DNA-directed RNA polymerase III subunit RPC6 (Gene Name=POLR3F)

[Back to BioLiP]