Structure of PDB 8gy7 Chain P Binding Site BS01

Receptor Information
>8gy7 Chain P (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSW
S
Ligand information
>8gy7 Chain M (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYSMEHFRWGKPVGKKRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8gy7 Structural basis of signaling regulation of the human melanocortin-2 receptor by MRAP1.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		S13 Y14 E15 Y16 Y17 L18 D19 Y20 L21
Binding residue
(residue number reindexed from 1)		S1 Y2 E3 Y4 Y5 L6 D7 Y8 L9
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030545 signaling receptor regulator activity
GO:0031780 corticotropin hormone receptor binding
GO:0031781 type 3 melanocortin receptor binding
GO:0031782 type 4 melanocortin receptor binding
GO:0031783 type 5 melanocortin receptor binding
GO:0042802 identical protein binding
GO:0070996 type 1 melanocortin receptor binding
Biological Process
GO:0072659 protein localization to plasma membrane
GO:0106070 regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0106071 positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0106072 negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:1903077 negative regulation of protein localization to plasma membrane
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gy7, PDBe:8gy7, PDBj:8gy7
PDBsum8gy7
PubMed36588120
UniProtQ8TCY5|MRAP_HUMAN Melanocortin-2 receptor accessory protein (Gene Name=MRAP)

[Back to BioLiP]