Structure of PDB 7x8x Chain P Binding Site BS01

Receptor Information

>7x8x Chain P (length=177) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYIN
SPGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYAL
PHARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERI
EADSDRDRWFTAAEALEYGFVDHIITR

Ligand information

>7x8x Chain t (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7x8x structural insights into Mycobacterium tuberculosis ClpP1P2 inhibition by Cediranib: implications for developing antimicrobial agents targeting Clp protease
Resolution	3.24 Å
Binding residue (original residue number in PDB)	G68 G69 S70 I71 S98 M99 H123 P125 L126 F143
Binding residue (residue number reindexed from 1)	G53 G54 S55 I56 S83 M84 H108 P110 L111 F128

Enzymatic activity

Enzyme Commision number

3.4.21.92: endopeptidase Clp.

Gene Ontology

	Molecular Function
GO:0004176	ATP-dependent peptidase activity
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7x8x, PDBe:7x8x, PDBj:7x8x
PDBsum	7x8x
PubMed
UniProt	P9WPC5\|CLPP1_MYCTU ATP-dependent Clp protease proteolytic subunit 1 (Gene Name=clpP1)

[Back to BioLiP]