Structure of PDB 7w59 Chain P Binding Site BS01

Receptor Information
>7w59 Chain P (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTAARPTFEPARGGRGKQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNR
DFRRELEERERAAAREKNRDRWDDDVVFKNCAKGVDDQKKDKRFVNDTLR
SEFHKKFMEKYIK
Ligand information
>7w59 Chain B (length=84) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuuccg
uggagaggaacaacccaauuuuuugaggccuugc
.<<<<<<<<<<<........<<<<<<<<...........>>>>>>>>...
>>>>>>>>>>>.......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w59 Mechanism of exon ligation by human spliceosome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
S32 R33 P36 S37 H38
Binding residue
(residue number reindexed from 1)
S25 R26 P29 S30 H31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005739 mitochondrion
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7w59, PDBe:7w59, PDBj:7w59
PDBsum7w59
PubMed35705093
UniProtQ9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)

[Back to BioLiP]