Structure of PDB 7vp3 Chain P Binding Site BS01

Receptor Information
>7vp3 Chain P (length=61) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAE
PAVIAATGTGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vp3 Structural basis for DNA recognition by TCP transcription factors
Resolution3.003 Å
Binding residue
(original residue number in PDB)		S51 T52 K53 D54 K58 G63 R67
Binding residue
(residue number reindexed from 1)		S1 T2 K3 D4 K8 G13 R17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7vp3, PDBe:7vp3, PDBj:7vp3
PDBsum7vp3
PubMed
UniProtQ9C9L2|TCP15_ARATH Transcription factor TCP15 (Gene Name=TCP15)

[Back to BioLiP]