Structure of PDB 7tr9 Chain P Binding Site BS01

Receptor Information
>7tr9 Chain P (length=240) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDILLVCLRFPFFSVAKRSYQVRTSFLLPPPSALKGALAKGLILLKPEKY
ASSSLDEAALKAIKEIESKLVDIKAVSVAPLSPLIRNAFLLKRLRNLESG
SNAEKSDAMRREYTFTRELLVAYIFKNLTQEEKNLYLKAAMLIDVIGDTE
SLATPVWASFVKPEDKKAPLAFSAPYTEIYSLRMYIEKMRVSPEYSQEEI
FYLPIEERRYKRIVYYARIYPPEVEKALTVDGEVLGIWIP
Ligand information
>7tr9 Chain R (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auugaaagagugcuuccccaaacccuuaacugguuguaacaguug
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tr9 Allosteric control of type I-A CRISPR-Cas3 complexes and establishment as effective nucleic acid detection and human genome editing tools.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		A16 K17 R18 F26 S32 A33 G36 K40 I43 L55 L90 L91 K92 R93 L94 L97 A108 V145 I146 G147 D148 T149 R201 Y206
Binding residue
(residue number reindexed from 1)		A16 K17 R18 F26 S32 A33 G36 K40 I43 L55 L90 L91 K92 R93 L94 L97 A108 V145 I146 G147 D148 T149 R190 Y195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Biological Process
External links
PDB RCSB:7tr9, PDBe:7tr9, PDBj:7tr9
PDBsum7tr9
PubMed35835111
UniProtA0A5C0XNV9

[Back to BioLiP]