Structure of PDB 7t2d Chain P Binding Site BS01

Receptor Information
>7t2d Chain P (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQ
AFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELG
QPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHY
LTFVPSAEDFYDCRVEHWGLDQPLLKHWEA
Ligand information
>7t2d Chain R (length=14) Species: 1313 (Streptococcus pneumoniae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATGLAWEWWRTVYE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t2d CD4 + T cell-mediated recognition of a conserved cholesterol-dependent cytolysin epitope generates broad antibacterial immunity.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Y9 A11 W43 F52 S53 G58 A61 N62 I65 N68 N69 T72
Binding residue
(residue number reindexed from 1)		Y9 A11 W43 F52 S53 G58 A61 N62 I65 N68 N69 T72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7t2d, PDBe:7t2d, PDBj:7t2d
PDBsum7t2d
PubMed37100059
UniProtP20036|DPA1_HUMAN HLA class II histocompatibility antigen, DP alpha 1 chain (Gene Name=HLA-DPA1)

[Back to BioLiP]