Structure of PDB 7qxs Chain P Binding Site BS01

Receptor Information
>7qxs Chain P (length=251) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNV
KLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLT
FIPRTSSKYFNFLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
TPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSF
LRIYSLHTKLLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLT
A
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qxs Structural basis of human telomerase recruitment by TPP1-POT1.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		F31 K33 K39 D42 F62 Y89 Y161 D224 S243 H266 G267 S270 Y271
Binding residue
(residue number reindexed from 1)		F26 K28 K34 D37 F57 Y84 Y123 D186 S205 H218 G219 S222 Y223
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0010521 telomerase inhibitor activity
GO:0017151 DEAD/H-box RNA helicase binding
GO:0042162 telomeric DNA binding
GO:0043047 single-stranded telomeric DNA binding
GO:0061821 telomeric D-loop binding
GO:0061849 telomeric G-quadruplex DNA binding
GO:0098505 G-rich strand telomeric DNA binding
GO:1905773 8-hydroxy-2'-deoxyguanosine DNA binding
GO:1990955 G-rich single-stranded DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0007004 telomere maintenance via telomerase
GO:0016233 telomere capping
GO:0032202 telomere assembly
GO:0032206 positive regulation of telomere maintenance
GO:0032210 regulation of telomere maintenance via telomerase
GO:0032211 negative regulation of telomere maintenance via telomerase
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0032508 DNA duplex unwinding
GO:0051096 positive regulation of helicase activity
GO:0060383 positive regulation of DNA strand elongation
GO:0061820 telomeric D-loop disassembly
GO:0070200 establishment of protein localization to telomere
GO:1905774 regulation of DNA helicase activity
GO:1905776 positive regulation of DNA helicase activity
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070187 shelterin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qxs, PDBe:7qxs, PDBj:7qxs
PDBsum7qxs
PubMed35201900
UniProtQ9NUX5|POTE1_HUMAN Protection of telomeres protein 1 (Gene Name=POT1)

[Back to BioLiP]