Structure of PDB 7ce1 Chain P Binding Site BS01

Receptor Information

>7ce1 Chain P (length=324) Species: 1453998 (Agrobacterium tumefaciens A6) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ERPTLKTIAYMTGLGITTVSRALKDAPDIGAETKERVRLIAQQIGYQPNR
AGVRLRTGKTNVIALVLSVDEELMGFTSQMVFGITEVLATTQYHLVVTPH
KDSMVPIRYILETGSADGVIISKIEPNDPRVRFMTERKMPFVTHGRSDMG
IEHAYHDFDNEAYAYEAVERLAQCGRKRIAIIVPPSRFAFHDHARKGFTR
GIRDFGVSEFPLDAITIETPLDKIRDFGKRLMQSDDRPDGIVSISGSSTI
ALVAGFEAAGVRIGKIDIVSKQSAEFLNWIQPQIHTVNEDIKLAGRELAK
ALLARINGAPPETLQSVSRPVWSS

Ligand information

>7ce1 Chain o (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tatctgcaacgttgcaga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ce1 Structural basis of a novel repressor, SghR, controllingAgrobacteriuminfection by cross-talking to plants.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	G32 T34 T35 D45 G47 T50 L72 R73
Binding residue (residue number reindexed from 1)	G15 T17 T18 D28 G30 T33 L55 R56

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7ce1, PDBe:7ce1, PDBj:7ce1
PDBsum	7ce1
PubMed	32651231
UniProt	A0A2I4PGE9

[Back to BioLiP]