Structure of PDB 6ven Chain P Binding Site BS01

Receptor Information
>6ven Chain P (length=42) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQTRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQS
Ligand information
>6ven Chain Q (length=29) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NTNVTPHLLAGMRLIDPLRVLGEYLIEQS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ven Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
Resolution3.37 Å
Binding residue
(original residue number in PDB)		Y125 V130 L150 G154 L157 I158
Binding residue
(residue number reindexed from 1)		Y6 V11 L31 G35 L38 I39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042800 histone H3K4 methyltransferase activity
Biological Process
GO:0031509 subtelomeric heterochromatin formation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0048188 Set1C/COMPASS complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ven, PDBe:6ven, PDBj:6ven
PDBsum6ven
PubMed31922488
UniProtQ03323|SDC1_YEAST COMPASS component SDC1 (Gene Name=SDC1)

[Back to BioLiP]