Structure of PDB 6r7q Chain P Binding Site BS01

Receptor Information
>6r7q Chain P (length=153) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE
Ligand information
>6r7q Chain 1 (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPVPYQPPFLCQWGRHQPAWKPLM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r7q Structural and mutational analysis of the ribosome-arresting human XBP1u.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R128 H133 G134 I136
Binding residue
(residue number reindexed from 1)		R127 H132 G133 I135
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r7q, PDBe:6r7q, PDBj:6r7q
PDBsum6r7q
PubMed31246176
UniProtG1SCJ6|RL17_RABIT Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]