Structure of PDB 6i3m Chain P Binding Site BS01

Receptor Information
>6i3m Chain P (length=396) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKI
YKCQEEISPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDA
ALLLIAGNESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHQ
KSILKFIRGTIADGAPIVPISAQLKYNIDAVNEFIVKTIPVPPRDFMISP
RLIVIRSFDVNKPGAEIEDLKGGVAGGSILNGVFKLGDEIEIRPGIVTIQ
CKPIFSNIVSLFAEQNDLKFAVPGGLIGVGTKVDPTLCRADRLVGQVVGA
KGHLPNIYTDIEINYFLLRRLLGVKKQAKVRKLEPNEVLMVNIGSTATGA
RVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKK
Ligand information
>6i3m Chain N (length=17) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VGLPYSELLSRFFNILR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i3m The structural basis of translational control by eIF2 phosphorylation.
Resolution3.93 Å
Binding residue
(original residue number in PDB)		Q248 Q263 I280 P282 S284 Y289 N290 D292 A293
Binding residue
(residue number reindexed from 1)		Q135 Q150 I167 P169 S171 Y176 N177 D179 A180
Enzymatic activity
Catalytic site (original residue number in PDB) A110 K113 S114 T137 H197
Catalytic site (residue number reindexed from 1) A13 K16 S17 T40 H84
Enzyme Commision number 3.6.5.3: protein-synthesizing GTPase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003743 translation initiation factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0031369 translation initiation factor binding
GO:1990856 methionyl-initiator methionine tRNA binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0045903 positive regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0016282 eukaryotic 43S preinitiation complex
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i3m, PDBe:6i3m, PDBj:6i3m
PDBsum6i3m
PubMed31086188
UniProtP32481|IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma (Gene Name=GCD11)

[Back to BioLiP]