Structure of PDB 6d84 Chain P Binding Site BS01

Receptor Information
>6d84 Chain P (length=415) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILA
HGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEE
SIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEAPRPPATVTNAVS
WRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMP
ELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPP
DGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTAN
NVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRA
HFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPW
VRYITQNGDYQLRTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6d84 HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation.
Resolution6.72 Å
Binding residue
(original residue number in PDB)		F172 N308 P383 Y384 R393 Y394 L395 I397 P407 W408 V409 R410
Binding residue
(residue number reindexed from 1)		F164 N300 P375 Y376 R385 Y386 L387 I389 P399 W400 V401 R402
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0032438 melanosome organization
GO:0035646 endosome to melanosome transport
GO:0060155 platelet dense granule organization
GO:1903232 melanosome assembly
Cellular Component
GO:0005765 lysosomal membrane
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0016020 membrane
GO:0030121 AP-1 adaptor complex
GO:0030131 clathrin adaptor complex
GO:0030665 clathrin-coated vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0032588 trans-Golgi network membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6d84, PDBe:6d84, PDBj:6d84
PDBsum6d84
PubMed30053425
UniProtP35585|AP1M1_MOUSE AP-1 complex subunit mu-1 (Gene Name=Ap1m1)

[Back to BioLiP]