Structure of PDB 6cnd Chain P Binding Site BS01

Receptor Information
>6cnd Chain P (length=277) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLSDNAKTLHSQMMSKGIGALFTQQELQKQMGIGSLTDLMSIVQELLDKN
LIKLVKQNDELKFQGVLESEAQKKATMSAEEALVYSYIEASGREGIWSKT
IKARTNLHQHVVLKCLKSLESQRYVKSVKSVKFPTRKIYMLYSLQPSVDE
LDIEFINSLLTIVWRFISENTFPNGFKNFENGPKKNVFYAPNVKNYSTTQ
EILEFITAAQVANVELTPSNIRSLCEVLVYDDKLEKVTHDCYRVTLESIL
QMSIFNYFKMFPASKHDKEVVYFDEWT
Ligand information
>6cnd Chain Y (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccatggagtcattttatcttgtgtcacttacagaaaaagtattactaata
tatgttgaaaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cnd Structural visualization of RNA polymerase III transcription machineries.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		Q118 K146
Binding residue
(residue number reindexed from 1)		Q109 K137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001056 RNA polymerase III activity
GO:0005515 protein binding
Biological Process
GO:0006383 transcription by RNA polymerase III
GO:0006384 transcription initiation at RNA polymerase III promoter
GO:0006386 termination of RNA polymerase III transcription
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cnd, PDBe:6cnd, PDBj:6cnd
PDBsum6cnd
PubMed30083386
UniProtP32910|RPC6_YEAST DNA-directed RNA polymerase III subunit RPC6 (Gene Name=RPC34)

[Back to BioLiP]