Structure of PDB 6ce7 Chain P Binding Site BS01

Receptor Information
>6ce7 Chain P (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QILKELEESSFRKTFEDYLHNVVFVPRPSR
Ligand information
>6ce7 Chain N (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ce7 Structure of the insulin receptor-insulin complex by single-particle cryo-EM analysis.
Resolution7.4 Å
Binding residue
(original residue number in PDB)
D707 F714 R717 P718 R720
Binding residue
(residue number reindexed from 1)
D17 F24 R27 P28 R30
Enzymatic activity
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
External links
PDB RCSB:6ce7, PDBe:6ce7, PDBj:6ce7
PDBsum6ce7
PubMed29512653
UniProtP06213|INSR_HUMAN Insulin receptor (Gene Name=INSR)

[Back to BioLiP]