Structure of PDB 5swz Chain P Binding Site BS01

Receptor Information
>5swz Chain P (length=238) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTLRCWALGFYP
ADITLTMELVETRPAGDGTFQKWASCRVYHEGLPEPLT
Ligand information
>5swz Chain R (length=9) Species: 11309 (unidentified influenza virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ASNENMETM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5swz Reversed T Cell Receptor Docking on a Major Histocompatibility Class I Complex Limits Involvement in the Immune Response.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 F116 T143 K146 W147 S150 H155 Y156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 Q70 W73 S77 N80 Y84 L95 Q97 F116 T143 K146 W147 S150 H155 Y156 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5swz, PDBe:5swz, PDBj:5swz
PDBsum5swz
PubMed27717799
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]