Structure of PDB 5mv3 Chain P Binding Site BS01

Receptor Information

>5mv3 Chain P (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIVLTQSPASLAVSLGQRATISCRASESVDNYGISSMNWFQQKAGQPPKF
LIYAASKQGSGVPARFSGSGSGTDFSLIIHPVEEDDTAVYFCQQSKGVPY
TFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINV
KWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA
THKTSTSPIVKSFNR

Ligand information

>5mv3 Chain Q (length=12) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PGGRGLTGPIGP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mv3 Anti-citrullinated protein antibodies cause arthritis by cross-reactivity to joint cartilage.
Resolution	2.95 Å
Binding residue (original residue number in PDB)	Y32 N38 F50 Y53 S95 Y100
Binding residue (residue number reindexed from 1)	Y32 N38 F50 Y53 S95 Y100

External links

PDB	RCSB:5mv3, PDBe:5mv3, PDBj:5mv3
PDBsum	5mv3
PubMed	28679953

[Back to BioLiP]