Structure of PDB 4pjo Chain P Binding Site BS01

Receptor Information
>4pjo Chain P (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKN
SKQAEREEKRVLGLVLLRGENLVSMTVEGPPPK
Ligand information
>4pjo Chain 3 (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuuaccuggcagugaggugcacacacugcauaauuugugguagu
...........<<<<<<.........>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q22 K36 H37 N39 R73 G74 E75
Binding residue
(residue number reindexed from 1)		Q17 K31 H32 N34 R68 G69 E70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP14678|RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B' (Gene Name=SNRPB)

[Back to BioLiP]