Structure of PDB 4p2r Chain P Binding Site BS01

Receptor Information
>4p2r Chain P (length=179) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKF
ASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGE
PNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYL
TFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p2r Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
Resolution3.295 Å
Binding residue
(original residue number in PDB)
Q9 E11 S53 F54 N62 V65 N69
Binding residue
(residue number reindexed from 1)
Q8 E10 S52 F53 N61 V64 N68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4p2r, PDBe:4p2r, PDBj:4p2r
PDBsum4p2r
PubMed24855945
UniProtP04224|HA22_MOUSE H-2 class II histocompatibility antigen, E-K alpha chain

[Back to BioLiP]