Structure of PDB 4g7h Chain P Binding Site BS01

Receptor Information

>4g7h Chain P (length=347) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDPDL
IREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYLHI
AREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEK
FEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRTAR
QLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEKD
SFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKGLI
DGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD

Ligand information

>4g7h Chain Q (length=16) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcatccgtgagtcgag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4g7h Structural basis of transcription initiation.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	D326 S327
Binding residue (residue number reindexed from 1)	D250 S251

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4g7h, PDBe:4g7h, PDBj:4g7h
PDBsum	4g7h
PubMed	23086998
UniProt	Q5SKW1

[Back to BioLiP]