Structure of PDB 4b1q Chain P Binding Site BS01

Receptor Information

>4b1q Chain P (length=30) Species: 101297 (Conus consors)

APWLVPSQITTCCGYNPGTMCPSCMCTNTC

Ligand information

• Ligand ID: GAL
• InChI: InChI=1S/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3+,4+,5-,6-/m1/s1
• InChIKey: WQZGKKKJIJFFOK-FPRJBGLDSA-N
• SMILES:
  CACTVS 3.370: OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O
  OpenEye OEToolkits 1.7.2: C(C1C(C(C(C(O1)O)O)O)O)O
  CACTVS 3.370: OC[CH]1O[CH](O)[CH](O)[CH](O)[CH]1O
  ACDLabs 12.01: OC1C(O)C(OC(O)C1O)CO
  OpenEye OEToolkits 1.7.2: C([C@@H]1[C@@H]([C@@H]([C@H]([C@@H](O1)O)O)O)O)O
• Formula: C6 H12 O6
• Name: beta-D-galactopyranose;
  beta-D-galactose;
  D-galactose;
  galactose
• ChEMBL: CHEMBL300520
• ZINC: ZINC000002597049
• PDB chain: 4b1q Chain A Residue 2

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4b1q Structure of the O-Glycosylated Conopeptide Cctx from Conus Consors Venom.
• Resolution: N/A
• Binding residue (original residue number in PDB): V5 P6
• Binding residue (residue number reindexed from 1): V5 P6
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0017080 sodium channel regulator activity
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism

Cellular Component

• GO:0005576 extracellular region
• GO:0044231 host cell presynaptic membrane

External links

• PDB: RCSB:4b1q, PDBe:4b1q, PDBj:4b1q
• PDBsum: 4b1q
• PubMed: 23281027
• UniProt: P58928|CEX_CONCN Conotoxin CcTx