Structure of PDB 3ucu Chain P Binding Site BS01

Receptor Information
>3ucu Chain P (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDI
Ligand information
>3ucu Chain R (length=92) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggucacgcacagggcaaaccauucgaaagagugggacgcaaagccuccgg
ccuaaaccauugcacuccgguagguagcgggguuaccgaugg
.....<.......<<...<<<<<<....>>>>>>...>>...<<<.<<<<
<<<..<<<..........>>>>>>>..>>>>>>....>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ucu Structural and biochemical characterization of linear dinucleotide analogues bound to the c-di-GMP-I aptamer.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K20 K22 L49 K50 M51 R52 Q54 F56 K80 Q85 K88 T89 S91
Binding residue
(residue number reindexed from 1)		Y7 N9 N10 E13 K14 K16 L43 K44 M45 R46 Q48 F50 K74 Q79 K82 T83 S85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3ucu, PDBe:3ucu, PDBj:3ucu
PDBsum3ucu
PubMed22148472
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]