Structure of PDB 3pdm Chain P Binding Site BS01

Receptor Information
>3pdm Chain P (length=162) Species: 185955 (Hibiscus latent Singapore virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PYLNLTPLNLIYTSGTFAPYDVFLEILVKSRSNSFQTQAGRDTLREQLIN
SLQIVANLNTRYPLLGFYVWVRNPTLAPVFEALLRATDTKNRIIEVEEES
RPTTAETLNATQRVDDATVAIHKEIDNILLLLQGGTAVYDRTAFEVASGL
SWADPTTTSTTT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pdm Structure of Hibiscus latent Singapore virus by fiber diffraction: A non-conserved His122 contributes to coat protein stability
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R113 D115 D116 A117 T118 V119 A120 K123
Binding residue
(residue number reindexed from 1)		R113 D115 D116 A117 T118 V119 A120 K123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid
GO:0019029 helical viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3pdm, PDBe:3pdm, PDBj:3pdm
PDBsum3pdm
PubMed21195089
UniProtQ8BE68

[Back to BioLiP]